PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02139g03005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 817aa    MW: 90362.2 Da    PI: 6.5423
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02139g03005.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.23.9e-0885127347
                               SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                               +WT +E+e +  a +q G++ +++I ++++  +   q++++++ +
  Niben101Scf02139g03005.1  85 AWTRQEEESFFSALRQVGKN-FEKITSRVQ-SKNKDQVRHYYYRL 127
                               6*****************99.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.01E-1080132IPR009057Homeodomain-like
PROSITE profilePS5129313.41381132IPR017884SANT domain
SMARTSM007173.2E-682130IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-584130IPR009057Homeodomain-like
PfamPF002493.3E-685127IPR001005SANT/Myb domain
CDDcd001678.93E-685128No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 817 aa     Download sequence    Send to blast
MQMEPQVSLE CDRCLHPETL MCEDGVSDDT QHPAAAQPVI ISEDDPASQL SVLIHDHAAT  60
QQVSLSQDQV MLQKPAKRQT RQWAAWTRQE EESFFSALRQ VGKNFEKITS RVQSKNKDQV  120
RHYYYRLVRR MNKLLGPELS LDAKNSKDTN AAMLRWWSLL EKSSCKASKL HLKPRRFKIF  180
IETLESQLMK DRKKNVRRRP SQGESSSTAA ASLSSHSRVS TNDSRTVKVV LLDNQDVQKF  240
GSGKGSSLKH HVTMGVNRSN TKVDSSPVKN ARHRRKIGSV STAAYKRWEK AAIAGVSLVA  300
DAAEHLERAT INKDVGLVQN SQGINGFEHV GKNVPSLPTL SQNLLNETNL QSCMKLKLQL  360
FPVDERTRRA LEMDNHNPYL ELTLSNRKKM SSILEHLNRK WGSSSIATGE LVLFPYHVQM  420
ENLVQSLRWT KDTTLSAADV YNLIGSPPVF RLRYGWFPNS ELGTFQAPLS STTPVTQNTN  480
TNITEEKNEE VLASSHGKLV HFSKEPLVSN PRMTVTSFST ELSGESNLQA TMGVNTYNSV  540
HNETLPMHRR ENGAITTEKQ VEMGNKNSAL SEGDWEDSLT NISVGDLLSD APDDEEADCI  600
ESTLPGSSHF LQPIPFSCDS FDAAIAAHIY KHQSKAESQM ALPPQASSIW NAEDTCDAFA  660
FQKDVACRRT AHNSSSNVGA ENGQHISQSS SLLLDAGVKD LPGKMDPLTD ESAHEDPVDE  720
CHAQALGGST KDLSGLSDIY WPDSLGPLEL DAPSCRYHSE DLILSDNSLG GLNRLIASSL  780
DAFQSCSFFG LDKKEPGSTV EAVETTSLAD YKIGAKV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016468803.10.0PREDICTED: TSL-kinase interacting protein 1-like isoform X2
SwissprotQ8LJT80.0TKI1_ARATH; TSL-kinase interacting protein 1
TrEMBLK4CQJ90.0K4CQJ9_SOLLC; Uncharacterized protein
STRINGSolyc09g008100.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA86401719
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36960.20.0TSL-kinase interacting protein 1